PDB entry 4el9

View 4el9 on RCSB PDB site
Description: Structure of N-terminal kinase domain of RSK2 with afzelin
Class: transferase/transferase inhibitor
Keywords: serine/threonine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-10, released 2012-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.226
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosomal protein S6 kinase alpha-3
    Species: Mus musculus [TaxId:10090]
    Gene: Rps6ka3, Mapkapk1b, Rps6ka-rs1, Rsk2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4el9a_
  • Heterogens: AFE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4el9A (A:)
    gamgsikeiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkv
    lkkatlkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdlftrlsk
    evmfteedvkfylaelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesidh
    ekkaysfcgtveymapevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmil
    kaklgmpqflspeaqsllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreih
    ppfkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4el9A (A:)
    eiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkatlk
    vrdrvrdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmfteedvkfy
    laelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesekkaysfcgtveyma
    pevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmpqflspeaq
    sllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp