PDB entry 4el8

View 4el8 on RCSB PDB site
Description: The unliganded structure of C.bescii CelA GH48 module
Class: hydrolase
Keywords: (A/A)6 BARRE, CelA, GH48, glycoside hydrolase, HYDROLASE
Deposited on 2012-04-10, released 2013-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.199
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 48
    Species: Caldicellulosiruptor bescii [TaxId:521460]
    Gene: Athe_1867
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4el8a_
  • Heterogens: CA, SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4el8A (A:)
    stpsvlgeygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyy
    vwleavygkltgdwskfktawdtlekymipsaedqpmrsydpnkpatyagewetpdkyps
    plefnvpvgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrg
    peesvwetvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakv
    wakeqgkfneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswy
    yawggaldgawswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqief
    yrwlqsaegaiaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsm
    qrvaeyyyvtgdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgn
    snlhvkvvdygtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdek
    glsapekradykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaa
    yksgqapefryhrfwaqcdiaianatyeilfgnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4el8A (A:)
    geygqrfmwlwnkihdpangyfnqdgipyhsvetliceapdyghlttseafsyyvwleav
    ygkltgdwskfktawdtlekymipsaedqpmsydpnkpatyagewetpdkypsplefnvp
    vgkdplhnelvstygstlmygmhwlmdvdnwygygkrgdgvsrasfintfqrgpeesvwe
    tvphpsweefkwggpngfldlfikdqnyskqwrytdapdadaraiqatywakvwakeqgk
    fneissyvakaakmgdylryamfdkyfkplgcqdknaaggtgydsahyllswyyawggal
    wswkigsshvhfgyqnpmaawalandsdmkpkspngasdwakslkrqiefyrwlqsaega
    iaggatnswngryekypagtatfygmayepnpvyhdpgsntwfgfqawsmqrvaeyyyvt
    gdkdagallekwvswvksvvklnsdgtfaipstldwsgqpdtwngaytgnsnlhvkvvdy
    gtdlgitaslanallyysagtkkygvfdegaknlakelldrmwklyrdekglsapekrad
    ykrffeqevyipagwigkmpngdviksgvkfidirskykqdpdwpkleaayksgqapefr
    yhrfwaqcdiaianatyeilf