PDB entry 4ekv

View 4ekv on RCSB PDB site
Description: Streptavidin 8-aa-loop H127C mutein with reversible biotin binding
Class: biotin-binding protein
Keywords: Beta-barrel, Binding protein, Biotin-binding, biotin-binding protein
Deposited on 2012-04-09, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (126)
    Domains in SCOPe 2.07: d4ekva_
  • Heterogens: BTN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ekvA (A:)
    dpskdskaqvsaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgdssngsd
    gstlvgcdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ekvA (A:)
    aaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgt
    algwtvawknnyrnahsattwsgqyvggaearintqwlltsstlvgcdtftkvkpsaasi
    daa