PDB entry 4ekl

View 4ekl on RCSB PDB site
Description: Akt1 with GDC0068
Class: transferase
Keywords: Phosphotransferase, TRANSFERASE
Deposited on 2012-04-09, released 2012-05-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-alpha serine/threonine-protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT1, PKB, RAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31749 (4-End)
      • engineered mutation (333)
      • see remark 999 (338)
    Domains in SCOPe 2.04: d4ekla_
  • Heterogens: 0RF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eklA (A:)
    gamarvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtlten
    rvlqnsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivs
    aldylhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylape
    vledndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksl
    lsgllkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfd
    eeftaqmititppdqddsmecvdserrphfpqfdysassta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eklA (A:)
    rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
    nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
    lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
    ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
    lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
    aqmititpsmecvdserrphfpqfdysass