PDB entry 4ekf

View 4ekf on RCSB PDB site
Description: Structure of the Inactive Adenovirus Proteinase at 0.98 Angstrom Resolution
Class: Hydrolase
Keywords: alpha and beta protein (a+b), Hydrolase
Deposited on 2012-04-09, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-06, with a file datestamp of 2013-02-01.
Experiment type: XRAY
Resolution: 0.98 Å
R-factor: 0.135
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenain
    Species: Human adenovirus 2 [TaxId:10515]
    Gene: L3-23k
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ekfa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ekfA (A:)
    mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
    nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
    acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
    hspyfrshsaqirsatsfchlknm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ekfA (A:)
    mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntaggvhwmafawnprs
    ktcylfepfgfsdqrlkqvyqfeyesllrrsaitlekstqsvqgpnsaacglfccmflha
    fanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerhspyfrshsaqi
    rsatsfchlknm