PDB entry 4ekb

View 4ekb on RCSB PDB site
Description: Initial Thaumatin Structure for Radiation Damage Experiment at 100 K
Class: Plant protein
Keywords: sweet protein, radiation damage, Plant protein
Deposited on 2012-04-09, released 2012-08-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.175
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thaumatin-1
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02883 (0-206)
      • see remark 999 (45)
      • see remark 999 (112)
    Domains in SCOPe 2.06: d4ekba_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ekbA (A:)
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta