PDB entry 4ek1

View 4ek1 on RCSB PDB site
Description: Crystal Structure of Electron-Spin Labeled Cytochrome P450cam
Class: oxidoreductase
Keywords: electron spin, MTSL, double electron electron resonance, camphor, Cytochrome P450 fold, Monooxidase, Putidaredoxin, OXIDOREDUCTASE
Deposited on 2012-04-08, released 2012-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183
      • engineered mutation (47)
      • engineered mutation (57)
      • engineered mutation (84)
      • engineered mutation (135)
      • engineered mutation (189)
      • engineered mutation (284)
      • engineered mutation (333)
    Domains in SCOPe 2.07: d4ek1a_
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183
      • engineered mutation (47)
      • engineered mutation (57)
      • engineered mutation (84)
      • engineered mutation (135)
      • engineered mutation (189)
      • engineered mutation (284)
      • engineered mutation (333)
    Domains in SCOPe 2.07: d4ek1b_
  • Heterogens: HEM, CAM, K, MTN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ek1A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqecnvpdlvwtrsng
    ghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgcmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ek1A (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqecnvpdlvwtrsngghwiatrgql
    ireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgc
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ek1B (B:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqecnvpdlvwtrsng
    ghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgcmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ek1B (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqecnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    cmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattka