PDB entry 4ejl

View 4ejl on RCSB PDB site
Description: Apo HIV Protease (PR) dimer in closed form with fragment 1F1-N in the outside/top of flap
Class: hydrolase
Keywords: apo protease, allostery, fragment binding, HYDROLASE
Deposited on 2012-04-06, released 2013-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12499 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • conflict (40)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12499 (0-98)
      • engineered mutation (6)
      • engineered mutation (32)
      • conflict (40)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.02: d4ejlb_
  • Heterogens: PEG, DMS, GOL, IOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ejlB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf