PDB entry 4ejk

View 4ejk on RCSB PDB site
Description: HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1-N in the outside/top of flap
Class: hydrolase/hydrolase inhibitor
Keywords: apo protease, allostery, fragment binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-04-06, released 2013-05-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12499 (0-98)
      • conflict (6)
      • conflict (40)
    Domains in SCOPe 2.04: d4ejka_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12499 (0-98)
      • conflict (6)
      • conflict (40)
    Domains in SCOPe 2.04: d4ejkb_
  • Chain 'N':
    Compound: pepstatin
    Database cross-references and differences (RAF-indexed):
    • PDB 4EJK (0-5)
  • Heterogens: IOP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ejkA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ejkB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'N':
    No sequence available.