PDB entry 4ejk
View 4ejk on RCSB PDB site
Description: HIV Protease (PR) dimer in closed form with pepstatin in active site and fragment 1F1-N in the outside/top of flap
Class: hydrolase/hydrolase inhibitor
Keywords: apo protease, allostery, fragment binding, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2012-04-06, released
2013-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated
2013-05-01, with a file datestamp of
2013-04-26.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.218
AEROSPACI score: 0.49
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P12499 (0-98)
- conflict (6)
- conflict (40)
Domains in SCOPe 2.03: d4ejka_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot P12499 (0-98)
- conflict (6)
- conflict (40)
Domains in SCOPe 2.03: d4ejkb_ - Chain 'N':
Compound: pepstatin
Database cross-references and differences (RAF-indexed):
- Heterogens: IOP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4ejkA (A:)
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4ejkB (B:)
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'N':
No sequence available.