PDB entry 4eji

View 4eji on RCSB PDB site
Description: Human Cytochrome P450 2A13 in complex with two molecules of 4-(methylnitrosamino)-1-(3-puridyl)-1-butanone
Class: oxidoreductase
Keywords: CYP2A13, cytochrome P450 2A13, P450 2A13, heme protein, monooxygenase, drug metabolism, xenobiotic metabolism, endoplasmic reticulum, membrane, OXIDOREDUCTASE
Deposited on 2012-04-06, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.203
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2A13
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2A13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ejia_
  • Heterogens: HEM, 0QA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ejiA (A:)
    makktsskgklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlc
    ghdavkealvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgk
    rgieeriqeeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsll
    rmmlgsfqftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpn
    sprdfidsflirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpe
    veakvheeidrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrd
    fflpkgtevfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfge
    glarmelflffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflprhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ejiA (A:)
    gklppgptplpfignylqlnteqmynslmkiserygpvftihlgprrvvvlcghdavkea
    lvdqaeefsgrgeqatfdwlfkgygvafsngerakqlrrfsiatlrgfgvgkrgieeriq
    eeagflidalrgthganidptfflsrtvsnvissivfgdrfdyedkeflsllrmmlgsfq
    ftatstgqlyemfssvmkhlpgpqqqafkelqgledfiakkvehnqrtldpnsprdfids
    flirmqeeeknpntefylknlvmttlnlffagtetvsttlrygflllmkhpeveakvhee
    idrvigknrqpkfedrakmpyteaviheiqrfgdmlpmglahrvnkdtkfrdfflpkgte
    vfpmlgsvlrdprffsnprdfnpqhfldkkgqfkksdafvpfsigkrycfgeglarmelf
    lffttimqnfrfkspqspkdidvspkhvgfatiprnytmsflpr