PDB entry 4ej0

View 4ej0 on RCSB PDB site
Description: Crystal structure of ADP-L-glycero-D-manno-heptose-6-epimerase from Burkholderia thailandensis
Class: isomerase
Keywords: ADP-L-glycero-D-manno-heptose-6-epimerase, Modified Rossmann Fold, epimeration, NADP Binding, cytosol, ISOMERASE
Deposited on 2012-04-06, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.188
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0a_
  • Chain 'B':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0b_
  • Chain 'C':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0c_
  • Chain 'D':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0d_
  • Chain 'E':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0e_
  • Chain 'F':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0f_
  • Chain 'G':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0g_
  • Chain 'H':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0h_
  • Chain 'I':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0i_
  • Chain 'J':
    Compound: ADP-l-glycero-d-manno-heptose-6-epimerase
    Species: Burkholderia thailandensis [TaxId:271848]
    Gene: hldD, BTH_I1644
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ej0j_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ej0A (A:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0A (A:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ej0B (B:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0B (B:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ej0C (C:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0C (C:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ej0D (D:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0D (D:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ej0E (E:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0E (E:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ej0F (F:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0F (F:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4ej0G (G:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0G (G:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ej0H (H:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0H (H:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ej0I (I:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0I (I:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4ej0J (J:)
    mhhhhhhgggggmtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdcei
    ddyldktefverfargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqg
    aqflyassaaiyggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfn
    vygpreshkgrmasvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyf
    fdhpeksgifnlgtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdal
    rgkyqcftqadqtklraagydapfltvqegvdryvrwlfgql
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ej0J (J:)
    mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
    fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
    ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
    asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
    gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
    tklraagydapfltvqegvdryvrwlfgql