PDB entry 4ehm

View 4ehm on RCSB PDB site
Description: RabGGTase in complex with covalently bound Psoromic acid
Class: transferase/transferase inhibitor
Keywords: prenylation, inhibition, Psoromic acid, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-04-02, released 2012-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl transferase type-2 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ggta, Rabggta
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08602 (0-236)
    • Uniprot Q08602 (241-329)
      • linker (237-240)
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-2 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ggtb, Rabggtb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ehmb_
  • Heterogens: PJA, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ehmB (B:)
    gtqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmg
    qlhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvva
    yvqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggf
    gcrpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcy
    swwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsll
    geeqikpvspvfcmpeevlqrvnvqpelvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ehmB (B:)
    qkdvtiksdapdtlllekhadyiasygsddyeycmseylrmsgvywgltvmdlmgqlhrm
    nkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvayvqsl
    qkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcrpg
    seshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcyswwvl
    aslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgeeqi
    kpvspvfcmpeevlqrvnvqpelvs