PDB entry 4eh7

View 4eh7 on RCSB PDB site
Description: Human p38 MAP kinase in complex with NP-F6 and RL87
Class: Transferase/Transferase inhibitor
Keywords: MAP Kinase Insert, Kinase-Ligand Complex, NP-Fragment, Transferase-Transferase inhibitor complex
Deposited on 2012-04-02, released 2012-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4eh7a_
  • Heterogens: IRG, 0OO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eh7A (A:)
    gsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eh7A (A:)
    erptfyrqelnktiwevperyqnlspvgsygsvcaafdtktglrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnw
    mhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarn
    yiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdde
    pvadpydqsfesrdllidewksltydevisfvpppld