PDB entry 4ego

View 4ego on RCSB PDB site
Description: The X-ray crystal structure of CYP199A4 in complex with indole-6-carboxylic acid
Class: oxidoreductase
Keywords: Cytochrome P450, Secondary metabolites biosynthesis, transport, catabolism, OXIDOREDUCTASE
Deposited on 2012-03-31, released 2013-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-20, with a file datestamp of 2013-02-15.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.184
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egoa_
  • Chain 'B':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egob_
  • Chain 'C':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egoc_
  • Chain 'D':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4egod_
  • Heterogens: HEM, 1F1, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4egoA (A:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egoA (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4egoB (B:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egoB (B:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4egoC (C:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egoC (C:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4egoD (D:)
    misnssaesisappndstiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygva
    ryaevhavlndpttfcssrgvglsdfkkekpwrppslileadppahtrpravlskvlspa
    tmktirdgfaaaadakvdellqrgcidaiadlaeayplsvfpdamglkqegrehllpyag
    lvfnafgppnelrqtaiersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeap
    llvrsllsagldttvngigaavyclarfpgelqrlrsdptlarnafeeavrfespvqtff
    rtttrevelggavigegekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcv
    gqlvarlegevmlsalarkvaaididgpvkrrfnntlrgleslpvkltpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egoD (D:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa