PDB entry 4egb

View 4egb on RCSB PDB site
Description: 3.0 Angstrom resolution crystal structure of dTDP-glucose 4,6-dehydratase (rfbB) from Bacillus anthracis str. Ames in complex with NAD
Class: lyase
Keywords: Rhamnose pathway, Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, Rossamn Fold, glucose-1-phosphate thymidylyltransferase, LYASE
Deposited on 2012-03-30, released 2012-04-18
Made obsolete by 6bi4 on 2017-11-08

The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.171
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egba1, d4egba2
  • Chain 'B':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbb1, d4egbb2
  • Chain 'C':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbc1, d4egbc2
  • Chain 'D':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbd1, d4egbd2
  • Chain 'E':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbe1, d4egbe2
  • Chain 'F':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbf1, d4egbf2
  • Chain 'G':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbg1, d4egbg2
  • Chain 'H':
    Compound: dtdp-glucose 4,6-dehydratase
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BAS1137, BA_1230, GBAA_1230, rfbB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81TP0 (24-End)
      • expression tag (23)
    Domains in SCOPe 2.06: d4egbh1, d4egbh2
  • Heterogens: SO4, NAD, NI, SUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4egbA (A:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbA (A:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtdghdrryainaekmknefdwepkytfeqglqetvqwy
    ekneewwkplk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4egbB (B:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbB (B:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaeipfydtnvigtvtllelvkkyphiklvqvstdevy
    gslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqypek
    liplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnektn
    vevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyekn
    eewwkplk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4egbC (C:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbC (C:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtdhdrryainaekmknefdwepkytfeqglqetvqwye
    kneewwkplk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4egbD (D:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbD (D:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyek
    neewwkplk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4egbE (E:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbE (E:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtdghdrryainaekmknefdwepkytfeqglqetvqwy
    ekneewwkplk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4egbF (F:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbF (F:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyek
    neewwkplk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4egbG (G:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbG (G:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaesipfydtnvigtvtllelvkkyphiklvqvstdev
    ygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqype
    kliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnekt
    nvevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwyek
    neewwkplk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4egbH (H:)
    mhhhhhhssgvdlgtenlyfqsnamnilvtggagfigsnfvhymlqsyetykiinfdalt
    ysgnlnnvksiqdhpnyyfvkgeiqngellehvikerdvqvivnfaaeshvdrsienpip
    fydtnvigtvtllelvkkyphiklvqvstdevygslgktgrfteetplapnspyssskas
    admialayyktyqlpvivtrcsnnygpyqypekliplmvtnalegkklplygdglnvrdw
    lhvtdhcsaidvvlhkgrvgevyniggnnektnvevveqiitllgktkkdieyvtdrlgh
    drryainaekmknefdwepkytfeqglqetvqwyekneewwkplkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4egbH (H:)
    amnilvtggagfigsnfvhymlqsyetykiinfdaltysgnlnnvksiqdhpnyyfvkge
    iqngellehvikerdvqvivnfaaeshipfydtnvigtvtllelvkkyphiklvqvstde
    vygslgktgrfteetplapnspyssskasadmialayyktyqlpvivtrcsnnygpyqyp
    ekliplmvtnalegkklplygdglnvrdwlhvtdhcsaidvvlhkgrvgevyniggnnek
    tnvevveqiitllgktkkdieyvtddrryainaekmknefdwepkytfeqglqetvqwye
    kneewwkplk