PDB entry 4eg3

View 4eg3 on RCSB PDB site
Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with product methionyl-adenylate
Class: ligase
Keywords: aminoacyl-tRNA synthetase, aaRS, MetRS, parasite, ligase, protein-inhibitor complex, Rossmann-fold, translation, nucleotide binding,, Rossmann Fold, tRNA binding ATP binding
Deposited on 2012-03-30, released 2012-09-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.214
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
  • Chain 'B':
    Compound: Methionyl-tRNA synthetase, putative
    Species: Trypanosoma brucei brucei [TaxId:999953]
    Gene: Tb10.70.6470
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38C91 (5-End)
      • expression tag (0-4)
      • conflict (77)
      • engineered mutation (220-222)
      • conflict (267)
      • conflict (271)
    Domains in SCOPe 2.03: d4eg3b1, d4eg3b2
  • Heterogens: GOL, ME8, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eg3B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
    frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
    yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
    lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
    dysdknmiarlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgt
    adhyylipdiqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttl
    llspilprksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrstentk
    st
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eg3B (B:)
    gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
    kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
    gdiylgryegwysisdesfltpqnitdgvdckvslesghvvtwvseenymfrlsafrerl
    lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
    altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
    plpkkivahgwwtkdrkkisknvfdpvekaeefgydalkyfllresgfsddgdysdknmi
    arlngeladtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylip
    diqkaiiavfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilpr
    ksvvifdmlgvpevhrkgienfefgavppgtrlgpavegevlfskrste