SCOPe 2.05: Structural Classification of Proteins

PDB entry 4eg2

View 4eg2 on RCSB PDB site
Description: 2.2 Angstrom Crystal Structure of Cytidine deaminase from Vibrio cholerae in Complex with Zinc and Uridine
Class: Hydrolase
Keywords: Cytidine deaminase, UMP synthesis, ZN binding, Hydrolase
Deposited on 2012-03-30, released 2012-05-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-05-02, with a file datestamp of 2012-04-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2a1, d4eg2a2
Chain 'B':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2b1, d4eg2b2
Chain 'C':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (2)
Domains in SCOPe 2.05: d4eg2c1, d4eg2c2
Chain 'D':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2d1, d4eg2d2
Chain 'E':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2e1, d4eg2e2
Chain 'F':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (2)
Domains in SCOPe 2.05: d4eg2f1, d4eg2f2
Chain 'G':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2g1, d4eg2g2
Chain 'H':
Compound: Cytidine deaminase
Species: Vibrio cholerae [TaxId:666]
Gene: cdd, VC_1231
Database cross-references and differences (RAF-indexed):
- Uniprot Q9KSM5 (3-297)
  - expression tag (1-2)
Domains in SCOPe 2.05: d4eg2h1, d4eg2h2
Heterogens: ZN, URI, ACT, MG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4eg2A (A:)
snamrnrieqalqqmpasfapylrelvlakdfdatfsaeqyqqlltlsgledadlrvall
piaaaysyapisefyvgaivrgisgrlylganmeftgaqlgqtvhaeqcaishawmkgek
gvaditinfspcghcrqfmnelttasslkiqlpkraaktlqeylpesfgpadlgidsglm
spvnhgktsdddeeliqqalramnishspytqnfsgvalkmrsgaiylgayaenaafnps
lpplqvalaqammmgesfedieaaalvesatgkishladtqatlevinpdiplsylsl