PDB entry 4efh

View 4efh on RCSB PDB site
Description: Acanthamoeba Actin complex with Spir domain D
Class: contractile protein/transport protein
Keywords: cytoskeleton, contractile protein, CONTRACTILE PROTEIN-TRANSPORT PROTEIN complex
Deposited on 2012-03-29, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.167
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-1
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4efha1, d4efha2
  • Chain 'B':
    Compound: Protein spire
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: spir, p150-Spir, CG10076
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4efhA (A:)
    mgdevqalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqs
    krgiltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmt
    qimfetfntpamyvaiqavlslyasgrttgivldsgdgvthtvpiyegyalphailrldl
    agrdltdylmkiltergysftttaereivrdikeklcyvaldfeqemhtaasssaleksy
    elpdgqvitignerfrapealfqpsflgmesagihettynsimkcdvdirkdlygnvvls
    ggttmfpgiadrmqkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiske
    eydesgpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4efhA (A:)
    vqalvidngsgmckagfagddapravfpsivgrprhtgqkdsyvgdeaqskrgiltlkyp
    iehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntp
    amyvaiqavlslyasgrttgivldsgdgvthtvpiyegyalphailrldlagrdltdylm
    kiltergysftttaereivrdikeklcyvaldfeqemhtaasssaleksyelpdgqviti
    gnerfrapealfqpsflgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgia
    drmqkeltalapstmkikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsiv
    hrkc
    

  • Chain 'B':
    No sequence available.