PDB entry 4eff

View 4eff on RCSB PDB site
Description: Crystal structure of aromatic-amino-acid aminotransferase from Burkholderia pseudomallei
Class: transferase
Keywords: SSGCID, Seattle Structural Genomics Center for Infectious Disease, structural genomics, TRANSFERASE
Deposited on 2012-03-29, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aromatic-amino-acid aminotransferase
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: BPSS0355, tyrB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4effa_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4effA (A:)
    mahhhhhhmgtleaqtqgpgsmslfsavelaprdpilglneafnadtrptkvnlgvgvyt
    nedgkipllravrdaekarveaglprgylpidgiaaydasvqklllgddspliaagrvvt
    aqalggtgalkigadflrtlnpkakvaisdpswenhralfdmagfevvaypyydaktngv
    nfdgmlaalngyepgtivvlhacchnptgvdlndaqwaqvvevvkarrlvpfldiayqgf
    gesieadaaavrlfaaanlnvfvsssfsksfslygervgalsiitdskdeaarvlsqlkr
    virtnysnppthggaivaavlaspelraswvqelgemrdriramrnglverlkaagierd
    fsfinaqrgmfsysgltsaqvdrlreefgiyavstgricvaalntrnldvvanaiaavlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4effA (A:)
    lglneafnadtrptkvnlgvgvytnedgkipllravrdaekarveaglprgylpidgiaa
    ydasvqklllgddspliaagrvvtaqalggtgalkigadflrtlnpkakvaisdpswenh
    ralfdmagfevvaypyydaktngvnfdgmlaalngyepgtivvlhacchnptgvdlndaq
    waqvvevvkarrlvpfldiayqgfgesieadaaavrlfaaanlnvfvsssfsksfslyge
    rvgalsiitdskdeaarvlsqlkrvirtnysnppthggaivaavlaspelraswvqelge
    mrdriramrnglverlkaagierdfsfinaqrgmfsysgltsaqvdrlreefgiyavstg
    ricvaalntrnldvvanaiaavl