PDB entry 4efa

View 4efa on RCSB PDB site
Description: Crystal Structure of the Heterotrimeric EGChead Peripheral Stalk Complex of the Yeast Vacuolar ATPase - second conformation
Class: hydrolase
Keywords: heterotrimer, peripheral stalk, vacuolar ATPase, HYDROLASE
Deposited on 2012-03-29, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: V-type proton ATPase subunit C
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VAT3, VATC, VMA5, YKL080W, YKL410
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: V-type proton ATPase subunit E
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: O6241, VAT5, VMA4, YOR332W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4efae1, d4efae2
  • Chain 'G':
    Compound: V-type proton ATPase subunit G
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: VMA10, YHR039BC, YHR039C-A, YHR039C-B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4efag_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4efaE (E:)
    mssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidg
    nfksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpi
    lqsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndyln
    kdlvsggvvvsnasdkieinntleerlkllseealpairlelygpsktrkffd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4efaE (E:)
    ssaitaltpnqvndelnkmqafirkeaeekakeiqlkadqeyeiektnivrnetnnidgn
    fksklkkamlsqqitkstiankmrlkvlsareqsldgifeetkeklsgiannrdeykpil
    qsliveallkllepkaivkalerdvdliesmkddimreygekaqrapleeivisndylnk
    dlvsggvvvsnasdkieinntleerlkllseealpairlelygps
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4efaG (G:)
    gpkvpmsqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelk
    efeqknaggvgelekkaeagvqgelaeikkiaekkkddvvkilietvikpsaevhinal
    

    Sequence, based on observed residues (ATOM records): (download)
    >4efaG (G:)
    sqkngiatllqaekeaheivskarkyrqdklkqaktdaakeidsykiqkdkelkefeqkn
    kaeagvqgelaeikkiaekkkddvvkilietvikp