PDB entry 4eew

View 4eew on RCSB PDB site
Description: Crystal structure of the Ubl domain of BAG6
Class: chaperone
Keywords: ubiquitin-like fold, gp78-binding, CHAPERONE
Deposited on 2012-03-28, released 2012-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.185
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Large proline-rich protein BAG6
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG6, BAT3, G3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eewa_
  • Chain 'B':
    Compound: Large proline-rich protein BAG6
    Species: Homo sapiens [TaxId:9606]
    Gene: BAG6, BAT3, G3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eewb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eewA (A:)
    gmepndststaveepdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrl
    iyqgrvlqddkklqeynvggkvihlver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eewA (A:)
    pdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkklq
    eynvggkvihlver
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eewB (B:)
    gmepndststaveepdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrl
    iyqgrvlqddkklqeynvggkvihlver
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eewB (B:)
    epdslevlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkkl
    qeynvggkvihlver