PDB entry 4ee0

View 4ee0 on RCSB PDB site
Description: Crystal structure of hH-PGDS with water displacing inhibitor
Class: Isomerase/Isomerase inhibitor
Keywords: Inhibitor, Solvent replacement, Isomerase-Isomerase inhibitor complex
Deposited on 2012-03-28, released 2012-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTS, HPGDS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ee0a1, d4ee0a2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTS, HPGDS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (1-198)
      • expression tag (0)
    Domains in SCOPe 2.07: d4ee0b1, d4ee0b2, d4ee0b3
  • Heterogens: MG, 0O4, GSF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ee0A (A:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ee0A (A:)
    pnykltyfnmrgraeiiryifayldiqyedhriepeikstlpfgkipilevdgltlhqsl
    aiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynap
    hlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaip
    avanwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ee0B (B:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ee0B (B:)
    hpnykltyfnmrgraeiiryifayldiqyedhriadwpeikstlpfgkipilevdgltlh
    qslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaeqdvkeqmfnelltyna
    phlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqai
    pavanwikrrpqtkl