PDB entry 4edb

View 4edb on RCSB PDB site
Description: Structures of monomeric hemagglutinin and its complex with an Fab fragment of a neutralizing antibody that binds to H1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic H1N1 influenza A viruses
Class: viral protein
Keywords: influenza virus, haemagglutinin, conformation, antibody, VIRAL PROTEIN
Deposited on 2012-03-27, released 2013-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edba_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edbb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edbc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edbd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edbe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:457457]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4edbf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4edbA (A:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncs
    vagwilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfem
    fpkesswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlw
    gvhhppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepg
    dtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhp
    vtigecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
    ilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfemfpke
    sswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlwgvhh
    ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
    feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
    ecpkyvrsaklrmvtglrnipsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4edbB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4edbC (C:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncs
    vagwilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfem
    fpkesswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlw
    gvhhppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepg
    dtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhp
    vtigecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
    ilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfemfpke
    sswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlwgvhh
    ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
    feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
    ecpkyvrsaklrmvtglrnipsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4edbD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydyp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4edbE (E:)
    adpgdticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncs
    vagwilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfem
    fpkesswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlw
    gvhhppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepg
    dtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhp
    vtigecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncsvagw
    ilgnpecelliskeswsyivekpnpengtcypghfadyeelreqlssvssferfemfpke
    sswpnhtvtgvsascshngkssfyknllwltgknglypnlsksyannkekevlvlwgvhh
    ppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
    feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
    ecpkyvrsaklrmvtglrnipsi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4edbF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edbF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydyp