PDB entry 4eda

View 4eda on RCSB PDB site
Description: Structures of monomeric hemagglutinin and its complex with an Fab fragment of a neutralizing antibody that binds to H1 subtype influenza viruses: molecular basis of infectivity of 2009 pandemic H1N1 influenza A viruses
Class: viral protein
Keywords: influenza virus, haemagglutinin, conformation, antibody, VIRAL PROTEIN
Deposited on 2012-03-27, released 2013-05-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4edaa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4edac_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:644289]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4edaA (A:)
    adpgyllefdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplh
    lgkcniagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssf
    erfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgk
    evlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyyw
    tlvepgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslp
    fqnihpitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edaA (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4edaC (C:)
    adpgyllefdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplh
    lgkcniagwilgnpeceslstasswsyivetsssdngtcypgdfidyeelreqlssvssf
    erfeifpktsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgk
    evlvlwgihhpstsadqqslyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyyw
    tlvepgdkitfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslp
    fqnihpitigkcpkyvkstklrlatglrnvpsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4edaC (C:)
    nstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagwilgnpecesl
    stasswsyivetsssdngtcypgdfidyeelreqlssvssferfeifpktsswpnhdsnk
    gvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgihhpstsadqqs
    lyqnadayvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdkitfeatgnlvv
    pryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpitigkcpkyvkst
    klrlatglrnv
    

  • Chain 'D':
    No sequence available.