PDB entry 4eci

View 4eci on RCSB PDB site
Description: Crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with acetate
Class: transferase
Keywords: transferase-like protein, transcription regulation, transferase
Deposited on 2012-03-26, released 2012-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Pseudomonas aeruginosa [TaxId:388272]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02KA8 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d4ecia1, d4ecia2, d4ecia3
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Pseudomonas aeruginosa [TaxId:388272]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02KA8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ecib1, d4ecib2, d4ecib3
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eciA (A:)
    mvmidlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdr
    dnddfavfesgailiylaektgqlmpadvkgrsrviqwlmfqmggvgpmqgqanvffryf
    peklqgaidryqhetrrlyevldgrlgeaeylagdysiadiatypwvrihdwsgvavdgl
    dnlqrwiaaiearpavqrgllvprrekegddairtaqsmltraenlyfqshhhhhhwshp
    qfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eciA (A:)
    vmidlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdrd
    nddfavfesgailiylaektgqlmpadvkgrsrviqwlmfqmggvgpmqgqanvffryfp
    eklqgaidryqhetrrlyevldgrlgeaeylagdysiadiatypwvrihdwsgvavdgld
    nlqrwiaaiearpavqrgllvprr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eciB (B:)
    mvmidlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdr
    dnddfavfesgailiylaektgqlmpadvkgrsrviqwlmfqmggvgpmqgqanvffryf
    peklqgaidryqhetrrlyevldgrlgeaeylagdysiadiatypwvrihdwsgvavdgl
    dnlqrwiaaiearpavqrgllvprrekegddairtaqsmltraenlyfqshhhhhhwshp
    qfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eciB (B:)
    mvmidlytaatpnghkvsialeemglpyrvhalsfdkkeqkapeflrinpngripaivdr
    dnddfavfesgailiylaektgqlmpadvkgrsrviqwlmfqmggvgpmqgqanvffryf
    peklqgaidryqhetrrlyevldgrlgeaeylagdysiadiatypwvrihdwsgvavdgl
    dnlqrwiaaiearpavqrgllvpr