PDB entry 4ec2

View 4ec2 on RCSB PDB site
Description: Crystal structure of trimeric frataxin from the yeast Saccharomyces cerevisiae, complexed with ferrous
Class: transport protein
Keywords: alpha/beta sandwich, metallochaperone, iron-storage, transport protein
Deposited on 2012-03-26, released 2013-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frataxin homolog, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: YFH1, YDL120W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07540
      • engineered mutation (21)
    Domains in SCOPe 2.08: d4ec2a_
  • Heterogens: FE2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ec2A (A:)
    vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl
    eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
    ksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ec2A (A:)
    vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv
    inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk