PDB entry 4ec0

View 4ec0 on RCSB PDB site
Description: Crystal structure of hH-PGDS with water displacing inhibitor
Class: isomerase/isomerase inhibitor
Keywords: Inhibitor, Solvent replacement, isomerase-isomerase inhibitor complex
Deposited on 2012-03-26, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTS, HPGDS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ec0a1, d4ec0a2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTS, HPGDS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (1-199)
      • expression tag (0)
    Domains in SCOPe 2.07: d4ec0b1, d4ec0b2, d4ec0b3
  • Heterogens: GSH, MG, 7PQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ec0A (A:)
    hmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgl
    tlhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnel
    ltynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrk
    kvqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ec0A (A:)
    mpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ec0B (B:)
    hmpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgl
    tlhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnel
    ltynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrk
    kvqaipavanwikrrpqtkl