PDB entry 4ebv

View 4ebv on RCSB PDB site
Description: Structure of Focal Adhesion Kinase catalytic domain in complex with novel allosteric inhibitor
Class: transferase/transferase inhibitor
Keywords: Kinase Domain, Allosteric inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-03-25, released 2012-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.19
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2, FAK, FAK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05397 (28-303)
      • expression tag (27)
    Domains in SCOPe 2.05: d4ebva_
  • Heterogens: 0O7, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ebvA (A:)
    msyyhhhhhhdydipttenlyfqgamgsstrdyeiqrerielgrcigegqfgdvhqgiym
    spenpalavaiktcknctsdsvrekflqealtmrqfdhphivkligvitenpvwiimelc
    tlgelrsflqvrkysldlaslilyayqlstalayleskrfvhrdiaarnvlvssndcvkl
    gdfglsrymedstyykaskgklpikwmapesinfrrftsasdvwmfgvcmweilmhgvkp
    fqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprftelkaqlstilee
    ekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ebvA (A:)
    sstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekfl
    qealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayq
    lstalayleskrfvhrdiaarnvlvssndcvklgdfglklpikwmapesinfrrftsasd
    vwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydps
    rrprftelkaqlstileeekaq