PDB entry 4ebh

View 4ebh on RCSB PDB site
Description: The crystal structure of maltose O-acetyltransferase from Clostridium difficile 630 in complex with acetyl-CoA
Class: transferase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, TRANSFERASE
Deposited on 2012-03-23, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_08720, maa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q18A66 (3-187)
      • expression tag (2)
    Domains in SCOPe 2.07: d4ebha1, d4ebha2
  • Chain 'B':
    Compound: maltose o-acetyltransferase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD630_08720, maa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ebhb_
  • Heterogens: ACO, MES

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ebhA (A:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ebhA (A:)
    amtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkq
    inveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaql
    rnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrv
    ikkiee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ebhB (B:)
    snamtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvg
    kqinveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpida
    qlrnsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpc
    rvikkiee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ebhB (B:)
    mtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkqi
    nveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaqlr
    nsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrvi
    kkiee