PDB entry 4eb5

View 4eb5 on RCSB PDB site
Description: A. fulgidus IscS-IscU complex structure
Class: Transferase/metal binding protein
Keywords: scaffold, Transferase-metal binding protein complex
Deposited on 2012-03-23, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.212
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable cysteine desulfurase 2
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: iscS2, AF_0564
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29689
      • see remark 999 (15)
    Domains in SCOPe 2.07: d4eb5a_
  • Chain 'B':
    Compound: Probable cysteine desulfurase 2
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: iscS2, AF_0564
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29689
      • see remark 999 (15)
    Domains in SCOPe 2.07: d4eb5b_
  • Chain 'C':
    Compound: NifU protein (NifU-1)
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF_0185, AF_0565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eb5c_
  • Chain 'D':
    Compound: NifU protein (NifU-1)
    Species: Archaeoglobus fulgidus [TaxId:224325]
    Gene: AF_0185, AF_0565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4eb5d_
  • Heterogens: PLP, GOL, EPE, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eb5A (A:)
    mayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvnggg
    gtvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipv
    gkygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgq
    ievdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsi
    vgfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyie
    gesivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvd
    rllevlpgvierlrsmsplyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eb5A (A:)
    ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
    tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
    kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
    evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
    gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
    esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr
    llevlpgvierlrsmsply
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eb5B (B:)
    mayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvnggg
    gtvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipv
    gkygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgq
    ievdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsi
    vgfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyie
    gesivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvd
    rllevlpgvierlrsmsplyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eb5B (B:)
    ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
    tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
    kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
    evdvekigadmltissndiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
    gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
    esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr
    llevlpgvierlrsmsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4eb5C (C:)
    mysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaa
    aiatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrk
    ngkidkikelglekelekmekgemddhgeycea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eb5C (C:)
    ysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaaa
    iatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrkn
    gkidkikelglekelekm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4eb5D (D:)
    mysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaa
    aiatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrk
    ngkidkikelglekelekmekgemddhgeycea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eb5D (D:)
    ysdkvfdhfqnprnvgkiedadgvgtvgnpvcgdlmtiyikvkdnriedikfqtfgcaaa
    iatssmatemakgktieealkitrdavaealgglpkqkmhcsnlaadalrraivdyfrkn
    gkidkikelglekelekm