PDB entry 4eb0

View 4eb0 on RCSB PDB site
Description: Crystal structure of Leaf-branch compost bacterial cutinase homolog
Class: hydrolase
Keywords: Hydrolase, Serine esterase, Cutinase homolog, PET degradation, Metagenome
Deposited on 2012-03-23, released 2013-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lcc
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4eb0a_
  • Heterogens: SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eb0A (A:)
    snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy
    tadasslawlgrrlashgfvvlvintnsrfdypdsrasqlsaalnylrtsspsavrarld
    anrlavaghsmggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv
    sqhaipfyqnlpsttpkvyveldnashfapnsnnaaisvytiswmklwvdndtryrqflc
    nvndpalsdfrtnnrhcq