PDB entry 4ean

View 4ean on RCSB PDB site
Description: 1.75A resolution structure of indole bound beta-glycosidase (W33G) from sulfolobus solfataricus
Class: hydrolase
Keywords: GLYCOSIDE HYDROLASE, Chemical biology, allosteric activation, switchable enzyme, chemical rescue, HYDROLASE
Deposited on 2012-03-22, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.175
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus P2 [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (32)
    Domains in SCOPe 2.06: d4eana_
  • Chain 'B':
    Compound: beta-galactosidase
    Species: Sulfolobus solfataricus P2 [TaxId:273057]
    Gene: lacS, SSO3019
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22498 (0-488)
      • engineered mutation (32)
    Domains in SCOPe 2.06: d4eanb_
  • Heterogens: CL, IND, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4eanA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eanA (A:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpfdeskqdvteveinenelkrldeya
    nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
    farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
    haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrki
    vrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffp
    eglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylhw
    sladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvk
    plrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4eanB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitr
    gnekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfg
    weffpeglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvr
    gylhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlns
    vppvkplrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4eanB (B:)
    mysfpnsfrfgwsqagfqsemgtpgsedpntdgykwvhdpenmaaglvsgdlpengpgyw
    gnyktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrlde
    yankdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtv
    yefarfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramynii
    qaharaydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitk
    ivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweff
    peglydvltkywnryhlymyvtengiaddadyqrpyylvshvyqvhrainsgadvrgylh
    wsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppv
    kplrh