PDB entry 4eaf

View 4eaf on RCSB PDB site
Description: Thymidine phosphorylase from E.coli
Class: Transferase
Keywords: Thymidine phosphorylase, Transferase
Deposited on 2012-03-22, released 2013-03-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.16
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Gene: deoA, tpp, ttg, b4382, JW4345
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07650 (1-439)
      • expression tag (0)
    Domains in SCOPe 2.05: d4eafa1, d4eafa2, d4eafa3
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eafA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise