PDB entry 4ead

View 4ead on RCSB PDB site
Description: Thymidine phosphorylase from E.coli with 3'-azido-2'-fluoro-dideoxyuridine
Class: Transferase/Transferase inhibitor
Keywords: Thymidine phosphorylase, Transferase-Transferase inhibitor complex
Deposited on 2012-03-22, released 2013-03-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.147
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Gene: b4382, deoA, JW4345, tpp, ttg
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07650 (1-439)
      • expression tag (0)
    Domains in SCOPe 2.05: d4eada1, d4eada2, d4eada3
  • Heterogens: 0NP, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4eadA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise