PDB entry 4e9o

View 4e9o on RCSB PDB site
Description: Vaccinia D8L ectodomain structure
Class: viral protein
Keywords: CAH alpha fold, Vp7 motif, beta sheet, cell surface chondroitin binding, viral entry, chondroitin sulfate, VIRAL PROTEIN
Deposited on 2012-03-21, released 2012-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.174
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: IMV membrane protein
    Species: Vaccinia virus [TaxId:10245]
    Gene: VACAC2_124, VACCL3_124, VAC_DPP17_124
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e9ox_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4e9oX (X:)
    mpqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpne
    yvlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisif
    lqvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsada
    vwiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyysgeiira
    attsparenyfmrwlsdlretlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e9oX (X:)
    pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
    vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
    qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
    wiifptpinihsdqlskfrtllslsgkphyitenyrnpyklnddtevyys