PDB entry 4e8a

View 4e8a on RCSB PDB site
Description: The crystal structure of p38a MAP kinase in complex with PIA24
Class: transferase
Keywords: MAP kinase, p38, signal transduction, alternative activation modes, lipid binding site, PIA, perifosine, Kinase, phosphorylation, TRANSFERASE
Deposited on 2012-03-20, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4e8aa_
  • Heterogens: 0OA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e8aA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e8aA (A:)
    erptfyrqelnktiwevperyqnlspvggaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildtrwyrapeimlnwmhynqtv
    diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
    mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
    qsfesrdllidewksltydevisfvpp