PDB entry 4e71

View 4e71 on RCSB PDB site
Description: Crystal structure of the RHO GTPASE binding domain of Plexin B2
Class: signaling protein
Keywords: plexin, transmembrane, signaling, rbd, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2012-03-16, released 2012-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-B2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNB2, KIAA0315
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4e71a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4e71A (A:)
gllgddveyapltvsvivqdegvdaipvkvlncdtisqvkekiidqvyrgqpcscwprpd
svvlewrpgstaqilsdldltsqregrwkrvntlmhynvrdgatlilskvg

    Sequence, based on observed residues (ATOM records): (download) 
    >4e71A (A:)
eyapltvsvivqdegvdaipvkvlncdtisqvkekiidqvyrpdsvvlewrpstaqilsd
ldltsqrwkrvntlmhynvrdgatlilskv