PDB entry 4e6u

View 4e6u on RCSB PDB site
Description: Structure of LpxA from Acinetobacter baumannii at 1.4A resolution (P63 form)
Class: transferase
Keywords: lipopolysaccaride synthesis, TRANSFERASE
Deposited on 2012-03-16, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.176
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: lpxA, ABTW07_2294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6ua_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e6uA (A:)
    gagtsnhdlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggftrigq
    nneifqfasvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigshnllm
    vnthiahdcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmiggaslil
    kdvpayvmasgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaidqiks
    eilpsvpeaqllidsleqsergivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6uA (A:)
    dlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggftrigqnneifqf
    asvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigshnllmvnthiah
    dcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmiggaslilkdvpayv
    masgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaidqikseilpsvp
    eaqllidsleqsergivr