PDB entry 4e6t

View 4e6t on RCSB PDB site
Description: Structure of LpxA from Acinetobacter baumannii at 1.8A resolution (P212121 form)
Class: transferase
Keywords: lipopolysaccharide synthesis, TRANSFERASE
Deposited on 2012-03-15, released 2012-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: lpxA, ABTW07_2294
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0QHB3 (Start-293)
      • expression tag (25-30)
    Domains in SCOPe 2.07: d4e6ta1, d4e6ta2
  • Chain 'B':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: lpxA, ABTW07_2294
    Database cross-references and differences (RAF-indexed):
    • Uniprot F0QHB3 (Start-293)
      • expression tag (22-31)
    Domains in SCOPe 2.07: d4e6tb1, d4e6tb2
  • Chain 'C':
    Compound: acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: lpxA, ABTW07_2294
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4e6tc_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e6tA (A:)
    mgsshhhhhhssglvprgshmttenlyfqgagtsnhdlihstaiidpsaviasdvqigpy
    ciigpqvtigagtklhshvvvggftrigqnneifqfasvgevcqdlkykgeetwleignn
    nlirehcslhrgtvqdnaltkigshnllmvnthiahdcivgdhnifannvgvaghvhigd
    hvivggnsgihqfckidsysmiggaslilkdvpayvmasgnpahafginiegmrrkgwsk
    ntiqglreayklifksgltsvqaidqikseilpsvpeaqllidsleqsergivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6tA (A:)
    lyfqgadlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggftrigqn
    neifqfasvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigshnllmv
    nthiahdcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmiggaslilk
    dvpayvmasgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaidqikse
    ilpsvpeaqllidsleqsergivr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e6tB (B:)
    mgsshhhhhhssglvprgshmttenlyfqgagtsnhdlihstaiidpsaviasdvqigpy
    ciigpqvtigagtklhshvvvggftrigqnneifqfasvgevcqdlkykgeetwleignn
    nlirehcslhrgtvqdnaltkigshnllmvnthiahdcivgdhnifannvgvaghvhigd
    hvivggnsgihqfckidsysmiggaslilkdvpayvmasgnpahafginiegmrrkgwsk
    ntiqglreayklifksgltsvqaidqikseilpsvpeaqllidsleqsergivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6tB (B:)
    tenlyfqgaghdlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggft
    rigqnneifqfasvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigsh
    nllmvnthiahdcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmigga
    slilkdvpayvmasgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaid
    qikseilpsvpeaqllidsleqsergivr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e6tC (C:)
    mgsshhhhhhssglvprgshmttenlyfqgagtsnhdlihstaiidpsaviasdvqigpy
    ciigpqvtigagtklhshvvvggftrigqnneifqfasvgevcqdlkykgeetwleignn
    nlirehcslhrgtvqdnaltkigshnllmvnthiahdcivgdhnifannvgvaghvhigd
    hvivggnsgihqfckidsysmiggaslilkdvpayvmasgnpahafginiegmrrkgwsk
    ntiqglreayklifksgltsvqaidqikseilpsvpeaqllidsleqsergivr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6tC (C:)
    dlihstaiidpsaviasdvqigpyciigpqvtigagtklhshvvvggftrigqnneifqf
    asvgevcqdlkykgeetwleignnnlirehcslhrgtvqdnaltkigshnllmvnthiah
    dcivgdhnifannvgvaghvhigdhvivggnsgihqfckidsysmiggaslilkdvpayv
    masgnpahafginiegmrrkgwskntiqglreayklifksgltsvqaidqikseilpsvp
    eaqllidsleqsergivr