PDB entry 4e6s
View 4e6s on RCSB PDB site
Description: Crystal structure of the SCAN domain from mouse Zfp206
Class: transcription
Keywords: SCAN domain, protein interaction, other SCANs, N-terminal part, zinc finger transcription factor, TRANSCRIPTION
Deposited on
2012-03-15, released
2012-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-05-02, with a file datestamp of
2012-04-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.207
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Zinc finger and SCAN domain-containing protein 10
Species: Mus musculus [TaxId:10090]
Gene: Zscan10, Zfp206
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4e6sa_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4e6sA (A:)
grprpevahqlfrcfqyqedmgpraslgrlrelcnhwlrpalhtkkqilellvleqflsv
lpphvlsrlhgaplrdgeevaqlegvprdishm
Sequence, based on observed residues (ATOM records): (download)
>4e6sA (A:)
grprpevahqlfrcfqyqedmgpraslgrlrelcnhwlrpalhtkkqilellvleqflsv
lpphvlsrlhgaplrdgeevaqleg