PDB entry 4e6r

View 4e6r on RCSB PDB site
Description: Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution
Class: sugar binding protein
Keywords: SH3 domain, protein binding, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SUGAR BINDING PROTEIN
Deposited on 2012-03-15, released 2012-04-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic protein NCK2
    Species: Homo sapiens [TaxId:9606]
    Gene: BC007195, GRB4, NCK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43639 (1-57)
      • leader sequence (0)
    Domains in SCOPe 2.03: d4e6ra_
  • Chain 'B':
    Compound: Cytoplasmic protein NCK2
    Species: Homo sapiens [TaxId:9606]
    Gene: BC007195, GRB4, NCK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43639 (1-57)
      • leader sequence (0)
    Domains in SCOPe 2.03: d4e6rb_
  • Heterogens: ZN, IMD, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e6rA (A:)
    xipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e6rB (B:)
    xipafvkfayvaeredelslvkgsrvtvmekcsdgwwrgsyngqigwfpsnyvleevd