PDB entry 4e6i

View 4e6i on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant NVIAGA V99G at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, HYDROLASE
Deposited on 2012-03-15, released 2012-04-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-18, with a file datestamp of 2012-04-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (20)
      • engineered mutation (32)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d4e6ia_
  • Chain 'B':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (20)
      • engineered mutation (32)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (98)
      • engineered mutation (116)
      • engineered mutation (127)
    Domains in SCOPe 2.06: d4e6ib_
  • Heterogens: PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e6iA (A:)
    atstkklhkepatlikaidgntvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmgnealvrqglakvayvykgnnt
    heqhlrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6iA (A:)
    lhkepatlikaidgntvklmykgqpmvfrlllvdiygpeaaaftkkmvenakkievefdk
    gqrtdkygrglayiyadgkmgnealvrqglakvayvykgnntheqhlrkaeaqakkekln
    iws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e6iB (B:)
    atstkklhkepatlikaidgntvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmgnealvrqglakvayvykgnnt
    heqhlrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e6iB (B:)
    lhkepatlikaidgntvklmykgqpmvfrlllvdipygpeaaaftkkmvenakkievefd
    kgqrtdkygrglayiyadgkmgnealvrqglakvayvykgnntheqhlrkaeaqakkekl
    niws