PDB entry 4e5y

View 4e5y on RCSB PDB site
Description: Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
Class: oxidoreductase
Keywords: biosynthesis, GDP-L-fucose, OXIDOREDUCTASE
Deposited on 2012-03-15, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: TSTA3, SDR4E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e5ya_
  • Chain 'B':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: TSTA3, SDR4E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e5yb_
  • Chain 'C':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: TSTA3, SDR4E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e5yc_
  • Chain 'D':
    Compound: GDP-l-fucose synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: TSTA3, SDR4E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e5yd_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e5yA (A:)
    mgepqgsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5yA (A:)
    smrilvtggsglvgkaiqkvvadgagedwvfvsskdadltdtaqtralfekvqpthvihl
    aamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypidet
    mihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghvlp
    glihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgeede
    vsikeaaeavveamdfhgevtfdgqfkktasnsklrtylpdfrftpfkqavketcawftd
    nyeqark
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e5yB (B:)
    mgepqgsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5yB (B:)
    smrilvtggsglvgkaiqkvvadgagedwvfvsskdadltdtaqtralfekvqpthvihl
    aamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypidet
    mihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghvlp
    glihkvhlakssgsltvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgeedev
    sikeaaeavveamdfhgvtfdttksdqfkktasnsklrtylpdfrftpfkqavketcawf
    tdnyeqark
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e5yC (C:)
    mgepqgsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5yC (C:)
    smrilvtggsglvgkaiqkvvadgagedwvfvsskdadltdtaqtralfekvqpthvihl
    aamvgkynldfwrknvhmndnvlhsafevgarkvvsclstcifpdkttypidetmihngp
    phnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfniedghvlpglihgs
    altvwgtgnprrqfiysldlaqlfiwvlreynevepiilsvgeedevsikeaaeavveam
    dttksdgqfkktasnsklrtylpdfrftpfkqavketcawftdnyeqark
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e5yD (D:)
    mgepqgsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfek
    vqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpd
    kttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnf
    niedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepi
    ilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftp
    fkqavketcawftdnyeqark
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5yD (D:)
    pqgsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtralfekvqp
    thvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstcifpdktt
    ypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgphdnfnie
    dghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreynevepiils
    vgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdfrftpfkq
    avketcawftdnyeqark