PDB entry 4e5g

View 4e5g on RCSB PDB site
Description: Crystal structure of avian influenza virus PAn bound to compound 2
Class: viral protein, transcription
Keywords: endonuclease domain, H5N1 subtype, VIRAL PROTEIN, TRANSCRIPTION
Deposited on 2012-03-14, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.07: d4e5ga_
  • Chain 'B':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.07: d4e5gb_
  • Chain 'C':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.07: d4e5gc_
  • Chain 'D':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.07: d4e5gd_
  • Heterogens: SO4, MN, XI7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e5gA (A:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5gA (A:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e5gB (B:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5gB (B:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e5gC (C:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5gC (C:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e5gD (D:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5gD (D:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraa