PDB entry 4e5a

View 4e5a on RCSB PDB site
Description: The W197A mutant of p38a MAP kinase
Class: transferase
Keywords: MAP kinase, p38, signal trunsduction, alternative activation modes, Kinase tompoly, kinase, Phosphorylaiton, TRANSFERASE
Deposited on 2012-03-14, released 2012-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.211
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered mutation (196)
    Domains in SCOPe 2.06: d4e5ax_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4e5aX (X:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnamhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5aX (X:)
    qerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsi
    ihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivtddhv
    qfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfatrwyrapeimlnamhyn
    qtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqs
    ltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvad
    pydqsfesrdllidewksltydevisfvpppl