PDB entry 4e4s

View 4e4s on RCSB PDB site
Description: Crystal structure of Pika GITRL
Class: immune system
Keywords: GITRL, GLUCOCORTICOID-INDUCED TNF RECEPTOR LIGAND, IMMUNE SYSTEM, TNFRSF18, Structural genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, IFN
Deposited on 2012-03-13, released 2012-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.148
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4sa_
  • Chain 'B':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4sb_
  • Chain 'C':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4sc_
  • Chain 'D':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4sd_
  • Chain 'E':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4se_
  • Chain 'F':
    Compound: Tumor necrosis factor ligand superfamily member 18
    Species: Ochotona princeps [TaxId:9978]
    Gene: Gitrl
    Database cross-references and differences (RAF-indexed):
    • PDB 4E4S
    Domains in SCOPe 2.07: d4e4sf_
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e4sA (A:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sA (A:)
    pcvakfgpspsewqmasclnkmsdwklrilqnglyaiygrvtpnptykgfapfevqlckn
    kdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e4sB (B:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sB (B:)
    pcvakfgpspsewqmassesclnkmsdwklrilqnglyaiygrvtpnptykgfapfevql
    ckndaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e4sC (C:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sC (C:)
    pcvakfgpspsewqmasclnkmsdwklrilqnglyaiygrvtpnptykgfapfevqlckn
    kdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e4sD (D:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sD (D:)
    pcvakfgpspsewqmsclnkmsdwklrilqnglyaiygrvtpnptykgfapfevqlcknk
    daiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4e4sE (E:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sE (E:)
    kdpcvakfgpspsewqmassesclnkmsdwklrilqnglyaiygrvtpnptykgfapfev
    qlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4e4sF (F:)
    makdpcvakfgpspsewqmassessclnkmsdwklrilqnglyaiygrvtpnptykgfap
    fevqlcknkdaiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillan
    pqfgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4sF (F:)
    pcvakfgpspsewqmsclnkmsdwklrilqnglyaiygrvtpnptykgfapfevqlcknk
    daiqtltdsskiqnlgniyefnagdtielrfnsddqvlktntyfgiillanpqf