PDB entry 4e4d

View 4e4d on RCSB PDB site
Description: Crystal structure of mouse RANKL-OPG complex
Class: Cytokine/Signaling Protein
Keywords: TNF-Related Activation-Induced Cytokine-Receptor, Cysteine-Rich Domain, Jelly-Roll Fold, Cytokine-Signaling Protein complex
Deposited on 2012-03-12, released 2012-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'R':
  Compound: Tumor necrosis factor receptor superfamily member 11B
  Species: Mus musculus [TaxId:10090]
  Gene: Ocif, Opg, Osteoprotegerin, Tnfrsf11b
  Database cross-references and differences (RAF-indexed):
  • Uniprot O08712
• Chain 'X':
  Compound: Tumor necrosis factor ligand superfamily member 11, soluble form
  Species: Mus musculus [TaxId:10090]
  Gene: CD254, ODF, Opgl, Rankl, Tnfsf11, Trance
  Database cross-references and differences (RAF-indexed):
  • Uniprot O35235 (0-End)
  Domains in SCOPe 2.07: d4e4dx_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'R':
  No sequence available.
  
  
• Chain 'X':
  Sequence, based on SEQRES records: (download)
  

  >4e4dX (X:)
  qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
  rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
  lrageeisiqvsnpslldpdqdatyfgafkvqdid
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4e4dX (X:)
  qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
  rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
  lrageeisiqvsnpslldpdqdatyfgafkvqdi