PDB entry 4e4d

View 4e4d on RCSB PDB site
Description: Crystal structure of mouse RANKL-OPG complex
Class: Cytokine/Signaling Protein
Keywords: TNF-Related Activation-Induced Cytokine-Receptor, Cysteine-Rich Domain, Jelly-Roll Fold, Cytokine-Signaling Protein complex
Deposited on 2012-03-12, released 2012-10-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'R':
    Compound: Tumor necrosis factor receptor superfamily member 11B
    Species: Mus musculus [TaxId:10090]
    Gene: Ocif, Opg, Osteoprotegerin, Tnfrsf11b
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Tumor necrosis factor ligand superfamily member 11, soluble form
    Species: Mus musculus [TaxId:10090]
    Gene: CD254, ODF, Opgl, Rankl, Tnfsf11, Trance
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4e4dx_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'R':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4e4dX (X:)
    qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
    rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
    lrageeisiqvsnpslldpdqdatyfgafkvqdid
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e4dX (X:)
    qpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanicf
    rhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggffk
    lrageeisiqvsnpslldpdqdatyfgafkvqdi