PDB entry 4e3b

View 4e3b on RCSB PDB site
Description: Crystal structure of Tax-Interacting Protein-1 (TIP-1) PDZ domain bound to iCAL36-L (ANSRWPTSIL) peptide
Class: signaling protein/protein binding
Keywords: PDZ-peptide complex, SIGNALING PROTEIN-PROTEIN BINDING complex
Deposited on 2012-03-09, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.189
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e3ba_
  • Chain 'B':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4e3bb_
  • Chain 'C':
    Compound: iCAL50 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4E3B (Start-9)
  • Chain 'D':
    Compound: iCAL50 peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4E3B (Start-9)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e3bA (A:)
    avvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiag
    lqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4e3bB (B:)
    avvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaeiag
    lqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.